PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_58467.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family TALE
Protein Properties Length: 809aa    MW: 85473.4 Da    PI: 6.7711
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_58467.3genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.9e-096046411954
                   HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
      Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                   Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  MLOC_58467.3 604 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 641
                   554459******************************88 PP

2BELL118.63e-38465535272
          BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                   r e q+kkakL+s+l+eVd+rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  MLOC_58467.3 465 RFEQQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQL 535
                   6799****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF504944.71E-7156243IPR009003Peptidase S1, PA clan
SMARTSM005742.4E-67391533IPR006563POX domain
PfamPF075261.8E-52396532IPR006563POX domain
PROSITE profilePS5007112.6582645IPR001356Homeobox domain
SMARTSM003891.5E-9585649IPR001356Homeobox domain
CDDcd000863.63E-13585646No hitNo description
SuperFamilySSF466893.12E-17587652IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-28588651IPR009057Homeodomain-like
PfamPF059204.1E-18602641IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 809 aa     Download sequence    Send to blast
MGSSSSFFSL SDGCCRRTCQ VCCCARPAGE GDFFSLRRRP DDDDDSGAAS MGIAAPPCQA  60
TRQHVSTPKS SAAIHDDGRP ATASSMSHSQ GFHQGSSGVY GFSSDGFDRP GSSQDQQHQE  120
HDHVAQQSRR DKLRVQGFDP AAAGLLPIDG DQHVEPGAMY DHAAATGASN MLAEMFNFSA  180
QTPSGPSATE LLASQMNANY RFGFRQQAPG AVAGLPGDGG WFGSAGPGRA GVVLGGANLL  240
GETSSPKQQG GMAGLATDPA AAMQLFLMNP QQQQQSRSSP TSPPPSDAQS AIQHHEAFQA  300
YGNAASSFGG GGAGVVEGQG LSLSLSPSLQ QLEMAKQAEE LRVRDGVLYF NRQQQQQQQQ  360
QQAASVQQLP MALHGQVGSM GQQLHVGYGP AGVAGVLRNS KYTRAAQELL DEFCSVGRGQ  420
TIKGGGRGGS SSNPNASKGG PSSSGAAQSP SSASKEPPQL SPADRFEQQR KKAKLISMLD  480
EVDRRYNHYC DQMQMVVNFF DSVMGFGAAT PYTALAQKAM SRHFRCLKDA IAAQLRHTCE  540
LLGEKDAGTS SGLTKGETPR LRAIDQSLRQ QRAFHHMGMM EQEAWRPQRG LPERSVSILR  600
SWLFEHFLHP YPSDADKHLL ARQTGLSRNQ VSNWFINARV RLWKPMIEEM YQQETKELEG  660
SSAAAGGGGG GGPESGNDPS GADDLHSPTT TGSQQQLVIH HGGGRYGQQE HGMSGVHPHK  720
LDPGAGPSVA DAAFVGLDPA ELLGGDAHVG AADDLYGRFE PGVRMRYGPA TTGAVSGDVS  780
LTLGLQHAGA GNQGPDGSGR FSLRDYNGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A7e-17591648158Homeobox protein Meis1
4xrs_B7e-17591648158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3638800.0AK363880.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2019K09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981881.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ9SW801e-137BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLM0XAX50.0M0XAX5_HORVD; Uncharacterized protein
STRINGMLOC_58467.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-129BEL1-like homeodomain 4